PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010104264.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family Trihelix
Protein Properties Length: 292aa    MW: 34642 Da    PI: 8.4924
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010104264.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix85.37.6e-2741123186
        trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                     +W+ qe+++L+ +r e+++++ ++k++k lWe +++km+e+gf+rsp+qCk+kw+nl +ryk ++++e +   ++++++p++++l+
  XP_010104264.1  41 QWSMQETKELLMIRAELDQTFMETKRNKLLWEVIANKMKEKGFNRSPEQCKCKWKNLVTRYKGCETMEAE---TVRQQFPFYNELQ 123
                     7********************************************************************8...47788******98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007178.6E-438100IPR001005SANT/Myb domain
CDDcd122031.47E-2340105No hitNo description
PfamPF138378.0E-2241125No hitNo description
Gene3DG3DSA:1.10.10.604.0E-44197IPR009057Homeodomain-like
PROSITE profilePS500908.0144298IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005730Cellular Componentnucleolus
GO:0016592Cellular Componentmediator complex
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MEGHHHHHHH HQYQQQQQQQ QAIHHQQNIS VSVDVSDRFP QWSMQETKEL LMIRAELDQT  60
FMETKRNKLL WEVIANKMKE KGFNRSPEQC KCKWKNLVTR YKGCETMEAE TVRQQFPFYN  120
ELQAIFTARM QRMLWAEAEG TGSKKKAVAL SSDDDDDEHN DGSEGEQKGN IGSTMRKKMK  180
KVKAIGSSSG TTSGGGISSN NLKEILDDFM KQQMQMEAQW REAFEAREKE RRLKEMEWRQ  240
TMEALESERL MMERRWRERE EQRRMREEAR AEKRDALITA LLNKLRRDDH AS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ebi_A2e-1442121786DNA binding protein GT-1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010104264.10.0Trihelix transcription factor GT-3b
SwissprotO804506e-80TGT3B_ARATH; Trihelix transcription factor GT-3b
TrEMBLW9RYU50.0W9RYU5_9R
STRINGPOPTR_0006s10240.11e-115(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17813385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38250.11e-60Trihelix family protein